General Information

  • ID:  hor003921
  • Uniprot ID:  Q9YGK2
  • Protein name:  Corticotropin
  • Gene name:  pomc
  • Organism:  Thunnus obesus (Bigeye tuna)
  • Family:  POMC family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Thunnus (genus), Thunnini (tribe), Scombrinae (subfamily), Scombridae (family), Scombriformes (order), Pelagiaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SYSMEHFRWGKPVGRKRRPVKVYTSNGVEEESAEVFPGEM
  • Length:  40(93-132)
  • Propeptide:  MCPVWLLVAVVVVGGSRGAVSQCWEHPSCQELNSDSSMMECIQLCHSDLTAEKPVIPGNAHLQPPPLPDPSSSSSFILPSSSSSSSSPQSKRSYSMEHFRWGKPVGRKRRPVKVYTSNGVEEESAEVFPGEMRRRELASELLAAAEEEEEKAQEVMAEEEEEQKQLLQEKKDGSYKMKHFRWSGPPASKRYGGFMKSWDERSQRPLLTLFKNVINKDGQQQK
  • Signal peptide:  MCPVWLLVAVVVVGGSRG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the adrenal glands to release cortisol.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9YGK2-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor003921_AF2.pdbhor003921_ESM.pdb

Physical Information

Mass: 535400 Formula: C206H315N59O61S2
Absent amino acids: CDILQ Common amino acids: E
pI: 9.1 Basic residues: 8
Polar residues: 12 Hydrophobic residues: 9
Hydrophobicity: -97.5 Boman Index: -10618
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 38.75
Instability Index: 6122.25 Extinction Coefficient cystines: 8480
Absorbance 280nm: 217.44

Literature

  • PubMed ID:  NA
  • Title:  NA